D1.3 Mutation and gene editing
Mutation and gene editing explain how DNA sequence changes arise, affect proteins, create variation and can be studied or altered deliberately.
- Syllabus
- First assessment 2025
- Topic
- D1.3
- Level
- HL
Mutation and gene editing explain how DNA sequence changes arise, affect proteins, create variation and can be studied or altered deliberately.
A gene mutation is a change in the order or number of DNA bases within a gene. It creates a new sequence; its later effect depends on where the change occurs.
Mutation names describe the DNA change. They do not by themselves tell you whether a protein, cell or organism will be affected.

A base substitution replaces one nucleotide without changing sequence length. In a population, a one-base variant present among individuals is a single-nucleotide polymorphism (SNP).
| Coding outcome | Why it happens | Possible protein effect |
|---|---|---|
| silent | altered codon still specifies the same amino acid because the code is degenerate | primary structure unchanged |
| missense | altered codon specifies a different amino acid | folding or function may change |
| nonsense | altered codon becomes a stop codon | translation ends early |
A substitution outside a coding sequence can still matter if it changes a promoter or other regulatory sequence; some substitutions have no detectable effect.

A ribosome reads nucleotides in non-overlapping groups of three. Inserting or deleting a number of bases not divisible by three changes the grouping from that point onward: a frameshift.
Do not call every insertion or deletion a frameshift. Test whether the number of bases changed is a multiple of three.

DNA replication error or DNA damage → proofreading and repair act → unrepaired or misrepaired change persists → later replication copies the altered sequence
Changes can begin inside the cell through:
Mutagens increase mutation frequency by damaging DNA. Important classes include chemical mutagens, ionizing radiation such as X-rays, and ultraviolet radiation.
Exposure causes DNA damage probabilistically; it does not guarantee that a specific gene will mutate. Repair can restore the original sequence.
A mutation does not arise because an organism needs a useful trait. A change can occur before an environmental challenge and later prove harmful, neutral or advantageous.
Mutation probability can still vary with:
Random relative to need is not the same as equally likely at every base. Natural selection is the non-random filter; it does not direct the earlier mutation.

| Mutation location | Cells that can inherit it | Biological reach |
|---|---|---|
| germ-line lineage | gametes and potentially the offspring formed from them | can pass between generations |
| somatic cell | mitotic descendants of that body cell | remains within the individual and its cell clone |
A somatic mutation can contribute to cancer if it affects control of cell division, DNA repair or cell death. Further mutations and selection among cell clones can then expand the abnormal lineage.
A somatic mutation is not inherited by the person's offspring merely because many body cells carry it; it must enter the germ line to cross generations.

Mutation is the original source of new alleles. Recombination can reshuffle existing alleles, but it does not create a new DNA sequence at a locus.
new mutation → new allele → inheritance places the allele in a population → environment affects survival and reproduction → allele frequency may change over generations
Most new mutations are neutral or harmful in their current context; a smaller number can improve reproductive success under particular conditions. The same allele can have different effects in different environments.
Populations evolve because heritable allele frequencies change. An individual does not mutate adaptively and then evolve during its lifetime.
| Ask | What the answer predicts |
|---|---|
| What changed in the DNA? | substitution, insertion, deletion or duplication |
| Where is the change? | coding, regulatory or other sequence; possible molecular consequence |
| Which cell lineage carries it? | local somatic clone or possible inheritance through gametes |
| Does it alter reproductive success? | whether selection may change its frequency |
The causal chain can stop at any stage: a DNA change can be repaired, lie in a tolerant region, preserve the amino acid, or make no detectable phenotypic difference.
Mutation generates variants without foresight. Cell lineage controls their reach, and natural selection later filters heritable variation according to environmental conditions.
A gene knockout makes a selected gene non-functional. Researchers compare the knockout phenotype with an otherwise similar control to infer what the missing gene normally contributes.
selected gene active in control → normal gene product present → baseline phenotype
selected gene knocked out → gene product absent or reduced → any reproducible phenotype difference supports a role for that gene
A changed phenotype supports involvement, not a complete one-gene/one-trait explanation. Developmental compensation, background mutations and environmental differences must be controlled.

A knockout library contains organisms or cell lines in which different genes have been made non-functional. Researchers can screen the collection for a phenotype and identify candidate genes.
Common model organisms include:
Model organisms are useful because core genes, the genetic code and many cell processes are shared. They also have short generations, tractable breeding or large existing genetic resources.
A model result is evidence for a testable hypothesis in another species, not automatic proof that the gene has an identical effect in humans.
After viral infection, a bacterium can insert a short fragment of viral DNA as a spacer among CRISPR repeats in its own genome.
The spacer is transcribed into guide RNA. Its base sequence can pair with complementary DNA from the same virus during a later infection.
Guide RNA associates with a Cas nuclease. Complementary pairing positions the nuclease, which cuts the matching viral DNA and prevents successful replication.
Specificity comes from base pairing between guide RNA and target DNA; Cas9 supplies the cutting activity.
Researchers choose a target sequence and design a guide RNA with a complementary region. The guide RNA and Cas9 form a complex that searches DNA for a compatible target beside the required recognition motif.

Guide-target base pairing holds the complex at the selected site. Cas9 then makes a double-strand break in the DNA.
Cas9 makes the cut; the final edit is produced when the cell repairs that break. Similar off-target sequences can sometimes also be cut, so the result must be checked.
| Repair context | Likely sequence outcome | Typical use |
|---|---|---|
| ends rejoined without a supplied template | small insertions or deletions may disrupt the reading frame | gene disruption or knockout |
| two sites are cut | intervening segment can be deleted | targeted deletion |
| repair template is supplied | chosen sequence can be copied into the break | replacement or insertion |
define the intended edit → design guide RNA and, if needed, a donor template → deliver editing components → isolate edited cells or organisms → sequence the target → test the phenotype
A desired phenotype alone does not prove the intended edit caused it. Confirm the target sequence, examine plausible off-target sites and compare with suitable controls.
CRISPR-Cas9 can delete, replace, insert or disrupt DNA, but efficiency and precision depend on target sequence, delivery and the cell's repair pathway.
A conserved sequence remains identical or similar among species; a highly conserved sequence has changed little across long evolutionary time.
Read an alignment by columns. A position shared by all sampled species is conserved in that sample; a column containing different bases is variable.
Conservation can occur in protein-coding or regulatory DNA. The species sampled and the time since their divergence affect how strong the pattern appears.

| Hypothesis | Mechanism | Prediction |
|---|---|---|
| functional constraint with purifying selection | harmful variants reduce reproductive success and are removed | disrupting the sequence is likely to impair function |
| lower mutation rate | fewer sequence changes arise, perhaps because repair is especially effective | conservation can persist even before selection acts |
The explanations are not mutually exclusive. An essential sequence may both acquire mutations slowly and lose harmful variants rapidly through purifying selection.
Highly transcribed genes and their transcribed strands can show lower mutation rates, consistent with enhanced access to repair machinery.
Conservation suggests importance, but sequence comparison alone does not reveal the exact function. Knockout or targeted editing can test the hypothesis experimentally.
| Evidence route | Core question | Strength | Main caution |
|---|---|---|---|
| knockout | what changes when gene activity is removed? | supports a causal role | other changes and compensation need controls |
| CRISPR-Cas9 edit | what changes after a chosen sequence is altered? | tests a precise sequence hypothesis | edit and off-target sites must be verified |
| conservation | which positions persisted across evolution? | prioritizes likely functional regions | correlation does not identify exact function |
Conservation can nominate a candidate sequence → targeted editing can change it → phenotype and molecular measurements can test the predicted function → sequencing confirms what was actually altered.
The strongest inference combines comparative evidence with a controlled intervention. Neither an alignment nor an edited phenotype should be interpreted alone.
2 marks
Mutations may increase variation within a species. Compare and contrast substitution and insertion mutations.
4 marks
Outline how a base substitution leads to sickle cell anemia.
2 marks
Explain how chemical substances can cause cancer.
1 mark
What is a feature of mutations?
1 mark
A mutation in which type of cell could be inherited?
1 mark
What causes variation in both sexually and asexually reproducing organisms?
1 mark
What is gene knockout used for?
3 marks
Explain ways in which CRISPR-Cas9 gene editing could be used to change the mutated dystrophin protein produced.
1 mark
A bioinformatics analysis was performed on the protein PSY transcribed from the gene from corn and from daffodil to obtain the sequence alignment.
On the alignment, identify the longest part of the sequence where the consecutive amino acids are the same.
| Corn | ---MAI I LVRAASP-------GLSAAD---------SISH- |
|---|---|
| Daffodil | ---MVVAILRVVSAIEIPIRLGFSEANWRFSSPKYDNLGRK |
| Corn | QGTLQCSTLLKTKRPAARRWMPCSLLGLHPWEAGRP-SPAV |
| Daffodil | KSRLSVYSLYTTSKYA-----------CVGFEAENNGKFLI |
| * * * * * * | |
| Corn | YSSLPVNPAGEAVVSSEQKVYDVVLKQAALLKRQLRTP--V |
| Daffodil | RSSLVANPAGEATISSEQKVYDVVLKQAALVKDQTKSSRKS |
| * * * * * * * * * * * * * * * * * * * * * * * * * * * | |
| Corn | LDARPQDMDMPRN--GLKEAYDRCGE I CEEYAKTFYLGTML |
| Daffodil | TDVKP-DIVLPGTVYLLKDAYDRCGEVCAEYAKTFYLGTLL |
| * * * * * * * * * * * * * * * * * * * * * * * * | |
| Corn | MTEERRRA I WA I YVWCRRTDELVDGPNANY I TPTALDRWEK |
| Daffodil | MTPERRRAI WA I YVWCRRTDELVDGHNASHITPSALDRWEA |
| ** * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * | |
| Corn | RLEDLFTGRPYDMLDAALSDTISRFPIDIQPFRDMIEGMRS |
| Daffodil | RLEDLFAGRPYDMFDAALSDTVSRFPVDIQPFMDMVEGMRM |
| * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * | |
| Corn | DLRKTRYNNFDELYMYCYYVAGTVGLMSVPVMGIATESKAT |
| Daffodil | DLKKSRYKNFDELYLYCYYVAGTVGLMSVPVMGIAPESLAE |
| * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * | |
| Corn | TESVYSAALALGIANQLTNI LRDVGEDARRGRIYLPQDELA |
| Daffodil | AESVYNAALALGIANQLTNI LRDVGEDARRGRIYLPQDELA |
| * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * | |
| Corn | QAGLSDEDIFKGVVTNRWRNFMKRQIKRARMFFEEAERGVN |
| Daffodil | EAGLSDEDVFTGKVTDKWRSFMKRQIKRARTFFEQAEKGVT |
| * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * | |
| Corn | ELSQASRWPVWASLLLYRQI LDEIEANDYNNFTKRAYVGKG |
| Daffodil | E L SQA SRWP VWASLL LYRQI LDE I EANDYNNF TKRAYVSKV |
| Corn | KKLLALPVAYGKSLLLPCSLRN---GQT |
| Daffodil | KRLAALPLA YGKSLLIPLSLRPPSLSKA |
| * * * * * * * * * * * * * * * * |