D1.3 Mutation and gene editing
Mutation and gene editing explain how DNA sequence changes arise, affect proteins, create variation and can be studied or altered deliberately.
- Syllabus
- First assessment 2025
- Topic
- D1.3
- Level
- HL
Mutation and gene editing explain how DNA sequence changes arise, affect proteins, create variation and can be studied or altered deliberately.
A gene mutation is a change in the nucleotide sequence of a gene, created when DNA is altered or copied inaccurately.
The sequence can change one base or many. Its effect depends on where the change occurs and how it alters transcription, translation or regulation.
Classify a mutation by: sequence change; location; codon or regulatory effect; resulting phenotype.
Changing one base in a coding region may alter one codon, while a change in a promoter may change how much mRNA is made.
A mutation is a sequence change, not automatically a visible trait or disease.
This objective is assessed through structured response, commonly using Define / Identify / Distinguish.
Define / Identify / Distinguish / Compare
Build the answer around this relationship: Gene mutations are changes in DNA nucleotide sequence.
Naming a disease such as sickle-cell anemia instead of naming a mutation type.
Representative question
Mutations may increase variation within a species. Compare and contrast substitution and insertion mutations.
Similarity:
a. both involve changes in the sequence of DNA/bases/nucleotides/triplets
OR
both may cause the production of a different amino acid/protein/polypeptide;
Difference:
b. substitution changes a base/nucleotide while insertion adds a base/nucleotide
OR
substitution changes one triplet while insertion changes more / causes frameshift
OR
substitution may not change protein/polypeptide function while insertion usually does;
Marking guidance:
Accept codon in place of triplet.
b. the contrast between substitution and insertion must be clear.
2
max
Replacing one base can leave an amino acid unchanged, substitute a different amino acid or create a premature stop codon.
The outcome follows the genetic code and codon position. Degeneracy can make a substitution silent, while a changed residue or early stop can alter folding and protein length.
Trace: original codon; substituted base; new codon; code-table result; protein consequence.
A codon change from GAA to GAG can remain glutamate, while a change to a stop codon truncates the polypeptide.
A substitution is not always harmful; assess the codon and protein context.
This objective is assessed through structured response, multiple choice, commonly using Describe / Explain / Outline.
Describe / Explain / Outline
Build the answer around this relationship: A substitution changes one base in a DNA sequence.
Stopping at the DNA substitution without tracing the codon and amino acid consequence.
Representative question
Outline how a base substitution leads to sickle cell anemia.
a. substitution occurs in one base of a DNA triplet
OR
GAG is replaced by GTG;
b. mRNA is transcribed with the incorrect triplet/codon;
c. CAC instead of CUC;
d. a different amino acid is translated/ glutamic acid is replaced by valine;
e. altering a peptide/amino acid sequence in hemoglobin;
f. changes the shape of red blood cells / blood cells adopt a sickle shape OR
red cells carry less oxygen;
4 max
Adding or removing bases can cause a frameshift when the number changed is not a multiple of three, altering all downstream codons.
Ribosomes read triplets. A shifted grouping changes codons and often introduces an early stop, whereas a three-base insertion or deletion adds or removes one amino acid without shifting later codons.
Check: number of bases; reading-frame shift; downstream codons; stop signal.
Deleting one base near the start of a coding sequence changes every later triplet and can produce a nonfunctional protein.
Frameshift severity depends on location and rescue by a later change; it is not guaranteed to abolish function.
Mutations can result from spontaneous DNA-copying errors or from mutagens such as radiation and reactive chemicals.
Errors can escape proofreading or repair. Mutagens increase the probability of particular DNA damage, but the resulting sequence change still depends on repair and cell context.
Identify source: copying or chemical/physical damage; lesion; repair outcome; final sequence change.
Ultraviolet radiation can create abnormal base links that, if unrepaired, become a mutation after replication.
A mutagen raises risk; it does not dictate one inevitable mutation in every exposed cell.
This objective is assessed through structured response, commonly using State / Explain / Evaluate.
State / Explain / Evaluate / Identify
Build the answer around this relationship: Mutagens increase the frequency of DNA sequence changes.
Giving vague environmental factors without identifying radiation, chemicals or carcinogens.
Representative question
Explain how chemical substances can cause cancer.
a. cause mutations/act as mutagens;
b. in genes that control the cell cycle/cell division;
c. convert proto-oncogenes to oncogenes;
e. mutations in tumour suppressor genes;
2
Marking guidance:
max
Mutations arise without being directed toward an organism’s current need; selection later changes the frequency of variants.
DNA chemistry and copying produce changes before the environment ‘chooses’ among them. A useful phenotype becomes more common because its carriers leave more offspring, not because need creates the mutation.
Separate timeline: mutation appears; environment filters phenotypes; population frequency changes.
A bacterium resistant to an antibiotic may already carry a resistance mutation before exposure, then survive when the drug is applied.
Random with respect to need does not mean every mutation is equally likely or has equal effects.
This objective is assessed through multiple choice.
Build the answer around this relationship: Mutations are not directed by an organism’s needs.
Representative question
What is a feature of mutations?
They occur randomly.
They only occur in germ cells.
The frequency cannot be increased by external factors.
They only occur in certain base sequences of the genome.
A
A mutation in a germline cell can enter gametes and be inherited, while a somatic mutation remains in the affected body lineage unless special reproduction transfers it.
Cell lineage determines who receives the altered DNA. Germline changes can affect offspring; somatic changes can produce a mosaic tissue or disease in one individual.
Classify impact by checking: cell lineage; whether gametes carry the change; individuals or tissues affected.
A mutation in a skin cell can expand into a patch of altered cells but is usually not passed to a child.
‘Somatic’ does not mean harmless; it can strongly affect the individual even without inheritance.
This objective is assessed through multiple choice, commonly using Distinguish.
Distinguish
Build the answer around this relationship: Only germ-line mutations can normally be passed to offspring.
Saying any mutation can automatically be inherited regardless of cell type.
Representative question
A mutation in which type of cell could be inherited?
Beta cell in the pancreas
T-cell in the lymph
Sperm cell in the testis
Skeletal muscle cell in the diaphragm
C
Mutations introduce new alleles, providing genetic variation on which natural selection and other evolutionary processes can act.
Selection changes frequencies of existing variants; it does not create the initial DNA differences. Recombination and inheritance then distribute those alleles through populations.
Trace variation: DNA change; allele; heritable phenotype; differential reproduction; allele-frequency change.
A mutation that improves drought tolerance can become more common if carriers leave more offspring in dry conditions.
Mutation alone does not guarantee adaptation; the variant must be heritable and affect fitness in that environment.
This objective is assessed through multiple choice.
Build the answer around this relationship: Mutation produces new alleles.
Representative question
What causes variation in both sexually and asexually reproducing organisms?
Mutations
Polygenic inheritance
Crossing over
Independent assortment
A
Gene mutations are changes in the base sequence of DNA; main types are substitution, insertion, deletion, and duplication. Base substitutions can create SNPs and change codons; degeneracy can make substitutions silent, missense, or nonsense. Insertions or deletions not in multiples of three cause frameshifts that alter downstream codons and often disrupt protein function. Mutations can arise from replication errors, repair errors, or chromosome damage; mutagens include chemicals, ionizing radiation, and ultraviolet radiation. Mutations occur randomly with respect to organism need or advantage; mutation rate varies with DNA sequence, gene expression, repair, and mutagen exposure. Germ-line mutations can be inherited by offspring; somatic mutations affect only descendant body cells and can contribute to cancer. Mutation is the original source of new alleles and genetic variation; many are neutral or harmful, but variation supplies material for natural selection.
A gene knockout disables a gene so researchers can compare organisms or cells with and without its function.
The phenotype difference is evidence that the gene contributes to the affected process, especially when controls and rescue experiments support the link. Redundancy or compensation can hide effects.
Evaluate a knockout by checking: targeted gene; control; phenotype difference; alternative explanations.
Knocking out a transporter gene and observing loss of uptake suggests that the gene is required for that transport pathway.
A no-change phenotype does not prove the gene is useless; another gene may compensate.
This objective is assessed through multiple choice.
Build the answer around this relationship: Gene knockout deliberately makes a specific gene inoperative.
Representative question
What is gene knockout used for?
Increasing protein production by editing a gene
Investigating the function of a gene by replacing it to make it inoperative
Identifying the presence of a gene by editing it to produce a different protein
Editing a gene to initiate cell death
B
CRISPR-Cas9 gene editing uses a guide RNA to direct Cas9 to a complementary DNA sequence, where cutting enables targeted sequence change during repair.
Guide pairing positions the nuclease. The cell’s repair can create small disruptions or use a supplied template for a designed change, but repair outcomes are not perfectly predictable.
Trace: guide design; target pairing; Cas9 cut; repair pathway; edited sequence and verification.
A guide aimed at a disease-associated variant can direct a cut near that sequence, after which repair may disrupt or replace the target.
Targeted cutting is not guaranteed precision: off-target edits, delivery limits and repair variation require testing.
This objective is assessed through structured response, commonly using Explain.
Explain
Build the answer around this relationship: Guide RNA directs Cas9 to a complementary DNA target.
Representative question
Explain ways in which CRISPR-Cas9 gene editing could be used to change the mutated dystrophin protein produced.
a. gene editing requires a method for finding a target sequence in the genome/DNA/gene and replacing it with the desired sequence;
b. (gene editing could) change codon/point mutation/substitution that encodes/codes for a different amino acid (causing change in protein/dystrophin);
c. change codon that introduced a stop codon (making shorter peptide/dystrophin);
d. introduce DNA section/bases if mutation is a deletion;
e. delete DNA section/bases if mutation is an insertion;
a. both parts needed.
3 max
A conserved DNA sequence has remained similar across species because changes to it are often selected against or because its function is maintained.
Comparative sequence alignment can identify regions under constraint. Conservation suggests importance but does not by itself reveal the exact mechanism or prove every base is essential.
Use conservation as evidence by checking: species compared; sequence similarity; location; functional test or expression data.
A regulatory sequence conserved in many vertebrates may control a developmental gene, prompting experiments to test its role.
Conserved does not mean unchanged in every species or automatically beneficial; neutral conservation and linkage must be considered.
This objective is assessed through structured response, commonly using Identify.
Identify
Build the answer around this relationship: Conserved sequences are similar across species or long evolutionary times.
Representative question
A bioinformatics analysis was performed on the protein PSY transcribed from the gene from corn and from daffodil to obtain the sequence alignment.
On the alignment, identify the longest part of the sequence where the consecutive amino acids are the same.
\begin{tabular}{|l|l|}
\hline Corn & ---MAI I LVRAASP-------GLSAAD---------SISH- \\
\hline Daffodil & ---MVVAILRVVSAIEIPIRLGFSEANWRFSSPKYDNLGRK \\
\hline Corn & QGTLQCSTLLKTKRPAARRWMPCSLLGLHPWEAGRP-SPAV \\
\hline Daffodil & KSRLSVYSLYTTSKYA-----------CVGFEAENNGKFLI \\
\hline & * * * * * * \\
\hline Corn & YSSLPVNPAGEAVVSSEQKVYDVVLKQAALLKRQLRTP--V \\
\hline Daffodil & RSSLVANPAGEATISSEQKVYDVVLKQAALVKDQTKSSRKS \\
\hline & * * * * * * * * * * * * * * * * * * * * * * * * * * * \\
\hline Corn & LDARPQDMDMPRN--GLKEAYDRCGE I CEEYAKTFYLGTML \\
\hline Daffodil & TDVKP-DIVLPGTVYLLKDAYDRCGEVCAEYAKTFYLGTLL \\
\hline & * * * * * * * * * * * * * * * * * * * * * * * * \\
\hline Corn & MTEERRRA I WA I YVWCRRTDELVDGPNANY I TPTALDRWEK \\
\hline Daffodil & MTPERRRAI WA I YVWCRRTDELVDGHNASHITPSALDRWEA \\
\hline & ** * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * \\
\hline Corn & RLEDLFTGRPYDMLDAALSDTISRFPIDIQPFRDMIEGMRS \\
\hline Daffodil & RLEDLFAGRPYDMFDAALSDTVSRFPVDIQPFMDMVEGMRM \\
\hline & * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * \\
\hline Corn & DLRKTRYNNFDELYMYCYYVAGTVGLMSVPVMGIATESKAT \\
\hline Daffodil & DLKKSRYKNFDELYLYCYYVAGTVGLMSVPVMGIAPESLAE \\
\hline & * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * \\
\hline Corn & TESVYSAALALGIANQLTNI LRDVGEDARRGRIYLPQDELA \\
\hline Daffodil & AESVYNAALALGIANQLTNI LRDVGEDARRGRIYLPQDELA \\
\hline & * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * \\
\hline Corn & QAGLSDEDIFKGVVTNRWRNFMKRQIKRARMFFEEAERGVN \\
\hline Daffodil & EAGLSDEDVFTGKVTDKWRSFMKRQIKRARTFFEQAEKGVT \\
\hline & * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * \\
\hline Corn & ELSQASRWPVWASLLLYRQI LDEIEANDYNNFTKRAYVGKG \\
\hline Daffodil & E L SQA SRWP VWASLL LYRQI LDE I EANDYNNF TKRAYVSKV \\
\hline Corn & KKLLALPVAYGKSLLLPCSLRN---GQT \\
\hline Daffodil & KRLAALPLA YGKSLLIPLSLRPPSLSKA \\
\hline & * * * * * * * * * * * * * * * * \\
\hline
\end{tabular}
sequence shown on alignment:
Corn TESVYSAALALGIANQLTNILRDVGEDARRGRIYLPQDELA
Daffodil AESVYNAALALGIANQLTNILRDVGEDARRGRIYLPQDELA
**********************************************
Corn QAGLSDEDIFKGVVTNRWRNFMKRQIKRARMFFEEAERGVN
Daffodil EAGLSDEDVFTGKVTDKWRSFMKRQIKRARTFFEQAEKGVT
*************************************
Corn ELSQASRWPVWASLLLYRQILDEIEANDYNNFTKRAYVGKG
Corn KKLLALPVAYGKSLLLPCSLRN---GQT
Daffodil KRLAALPLAYGKSLLIPLSLRPPSLSKA
Gene knockout makes a specific gene non-functional to investigate phenotype; model organisms such as mice, Drosophila, zebrafish, and Arabidopsis support KO libraries. Guide RNA directs Cas9 to a complementary DNA target sequence; Cas9 cutting enables deletion, replacement, insertion, or gene disruption. Conserved sequences remain similar across species or long evolutionary times; conservation suggests essential function, lower mutation rate, or strong purifying selection.