D1.3 Mutation and gene editing
Mutation and gene editing explain how DNA sequence changes arise, affect proteins, create variation and can be studied or altered deliberately.
- Syllabus
- First assessment 2025
- Topic
- D1.3
- Level
- HL
Mutation and gene editing explain how DNA sequence changes arise, affect proteins, create variation and can be studied or altered deliberately.
A gene mutation is a structural change in the base sequence of DNA within a gene.
| Mutation | Sequence change |
|---|---|
| Substitution | One base is replaced by another |
| Insertion | One or more bases are added |
| Deletion | One or more bases are removed |
| Duplication | A DNA section is copied, producing an extra copy |
Changing 5′-ACT-3′ to 5′-AGT-3′ is a substitution; changing it to 5′-ACCT-3′ is an insertion.
A mutation is the DNA sequence change itself. Its effect on a codon, protein or phenotype is a possible consequence, not part of the definition.
This objective is assessed through structured response, commonly using Define / Identify / Distinguish.
Define / Identify / Distinguish / Compare
Build the answer around this relationship: Gene mutations are changes in DNA nucleotide sequence.
Naming a disease such as sickle-cell anemia instead of naming a mutation type.
Representative question
Mutations may increase variation within a species. Compare and contrast substitution and insertion mutations.
Similarity:
a. both involve changes in the sequence of DNA/bases/nucleotides/triplets
OR
both may cause the production of a different amino acid/protein/polypeptide;
Difference:
b. substitution changes a base/nucleotide while insertion adds a base/nucleotide
OR
substitution changes one triplet while insertion changes more / causes frameshift
OR
substitution may not change protein/polypeptide function while insertion usually does;
Marking guidance:
Accept codon in place of triplet.
b. the contrast between substitution and insertion must be clear.
2
max
A single-nucleotide polymorphism (SNP) results from a base substitution, but the substitution may or may not change one amino acid in a polypeptide.
| Codon outcome | Polypeptide consequence |
|---|---|
| Silent | The new codon specifies the same amino acid because the code is degenerate |
| Missense | The new codon specifies a different amino acid |
| Nonsense | The new codon is a stop codon, so translation ends early |
An mRNA codon change from GAA to GAG is silent because both specify glutamate; a change to a stop codon can shorten the polypeptide.
A substitution does not automatically change protein function. First identify the new codon and its amino-acid or stop outcome.
This objective is assessed through structured response, multiple choice, commonly using Describe / Explain / Outline.
Describe / Explain / Outline
Build the answer around this relationship: A substitution changes one base in a DNA sequence.
Stopping at the DNA substitution without tracing the codon and amino acid consequence.
Representative question
Outline how a base substitution leads to sickle cell anemia.
a. substitution occurs in one base of a DNA triplet
OR
GAG is replaced by GTG;
b. mRNA is transcribed with the incorrect triplet/codon;
c. CAC instead of CUC;
d. a different amino acid is translated/ glutamic acid is replaced by valine;
e. altering a peptide/amino acid sequence in hemoglobin;
f. changes the shape of red blood cells / blood cells adopt a sickle shape OR
red cells carry less oxygen;
4 max
Insertions and deletions are likely to stop a polypeptide functioning when they shift its reading frame or change a large section of its sequence.
Ribosomes read mRNA in triplets. Adding or removing a number of bases that is not a multiple of three regroups every downstream codon, often changing many amino acids and creating an early stop codon.
Not a multiple of three → frameshift and changed downstream codons. Multiple of three → no frameshift, but amino acids are added or removed. A major insertion or deletion can still disrupt structure and function even without a frameshift.
Deleting one base near the start of a coding sequence shifts the triplet grouping for most of the remaining mRNA and is therefore likely to produce a non-functional polypeptide.
A three-base insertion or deletion avoids a frameshift, but it is not automatically harmless because the added or missing amino acid may be important.
Gene mutations can result from errors in DNA replication or repair and from DNA damage caused by mutagens.
| Cause | Example or route to mutation |
|---|---|
| Replication error | An incorrect nucleotide escapes proofreading |
| Repair error | Damaged DNA is repaired with an altered base sequence |
| Chemical mutagen | NNK in tobacco smoke can increase DNA base-sequence changes |
| Ultraviolet radiation | UV can create abnormal links between adjacent bases |
| Ionizing radiation | X-rays or gamma rays can damage DNA, including strand breaks |
Damage is not yet a permanent mutation if accurate repair restores the original sequence. It becomes a mutation when the altered sequence remains and is copied.
A mutagen increases mutation probability; it does not produce the same mutation in every exposed cell.
This objective is assessed through structured response, commonly using State / Explain / Evaluate.
State / Explain / Evaluate / Identify
Build the answer around this relationship: Mutagens increase the frequency of DNA sequence changes.
Giving vague environmental factors without identifying radiation, chemicals or carcinogens.
Representative question
Explain how chemical substances can cause cancer.
a. cause mutations/act as mutagens;
b. in genes that control the cell cycle/cell division;
c. convert proto-oncogenes to oncogenes;
e. mutations in tumour suppressor genes;
2
Marking guidance:
max
Mutations occur randomly with respect to an organism's need: no known natural mechanism deliberately changes a particular base in order to create a useful trait.
A mutation can occur anywhere in the genome before its consequence is tested by the environment. Natural selection later changes variant frequencies because some carriers reproduce more successfully.
Random relative to need does not mean uniform probability. Base identity and sequence context, DNA repair, gene activity and mutagen exposure can make some sites or cells more likely to mutate than others.
Antibiotic exposure does not instruct bacteria to make a resistance mutation. A resistant variant may already exist, then increase in frequency when susceptible cells die.
Mutation bias can make some changes more frequent without making them purposeful or directed toward advantage.
This objective is assessed through multiple choice.
Build the answer around this relationship: Mutations are not directed by an organism’s needs.
Representative question
What is a feature of mutations?
They occur randomly.
They only occur in germ cells.
The frequency cannot be increased by external factors.
They only occur in certain base sequences of the genome.
A
The consequence of a mutation depends on whether it occurs in the germ line or in a somatic cell lineage.
| Location | Who can receive the mutation? | Important consequence |
|---|---|---|
| Germ-line cell or gamete | Offspring, if the mutated gene is transmitted at fertilization | The mutation can be inherited and enter the descendant's cell lineages |
| Somatic cell | Descendant body cells produced by mitosis | A clone of altered cells can form; mutations affecting growth control can contribute to cancer |
A mutation in a sperm cell may be inherited by a child, whereas a mutation acquired in one skin cell can spread through a local clone but is not normally passed to offspring.
Somatic does not mean harmless: a non-inherited mutation can still cause cancer or other serious effects in the individual.
This objective is assessed through multiple choice, commonly using Distinguish.
Distinguish
Build the answer around this relationship: Only germ-line mutations can normally be passed to offspring.
Saying any mutation can automatically be inherited regardless of cell type.
Representative question
A mutation in which type of cell could be inherited?
Beta cell in the pancreas
T-cell in the lymph
Sperm cell in the testis
Skeletal muscle cell in the diaphragm
C
Gene mutation is the original source of new alleles and therefore of all genetic variation.
Most mutations are neutral or harmful to an individual, but a population needs heritable variants for natural selection to act on. Selection changes allele frequencies; it does not create the initial DNA differences.
Mutation creates a new allele → inheritance can place it in a population → environmental conditions affect reproductive success → natural selection can change its frequency over generations.
A new allele that improves drought survival may spread when carriers leave more offspring in dry conditions, while the same allele may provide no advantage in another environment.
Mutation alone is not adaptation. The variant must be heritable and influence reproductive success in the relevant environment.
This objective is assessed through multiple choice.
Build the answer around this relationship: Mutation produces new alleles.
Representative question
What causes variation in both sexually and asexually reproducing organisms?
Mutations
Polygenic inheritance
Crossing over
Independent assortment
A
Gene mutations are changes in the base sequence of DNA; main types are substitution, insertion, deletion, and duplication. Base substitutions can create SNPs and change codons; degeneracy can make substitutions silent, missense, or nonsense. Insertions or deletions not in multiples of three cause frameshifts that alter downstream codons and often disrupt protein function. Mutations can arise from replication errors, repair errors, or chromosome damage; mutagens include chemicals, ionizing radiation, and ultraviolet radiation. Mutations occur randomly with respect to organism need or advantage; mutation rate varies with DNA sequence, gene expression, repair, and mutagen exposure. Germ-line mutations can be inherited by offspring; somatic mutations affect only descendant body cells and can contribute to cancer. Mutation is the original source of new alleles and genetic variation; many are neutral or harmful, but variation supplies material for natural selection.
Gene knockout investigates gene function by changing a chosen gene so that it becomes inoperative.
Researchers compare the knockout phenotype with an appropriate control. A consistent difference suggests that the disabled gene contributes to the affected process, while rescue or other controls strengthen the inference.
Libraries of knockout organisms are available for some research species, allowing scientists to study many genes systematically. Common model groups include mice, fruit flies, zebrafish and Arabidopsis plants.
If p53-knockout mice develop tumours and are then used to test anti-cancer treatments, the knockout model connects loss of the tumour-suppressor gene with the cancer phenotype.
Students do not need the technical steps used to create a knockout. A missing phenotype also does not prove that the gene has no function, because another gene may compensate.
This objective is assessed through multiple choice.
Build the answer around this relationship: Gene knockout deliberately makes a specific gene inoperative.
Representative question
What is gene knockout used for?
Increasing protein production by editing a gene
Investigating the function of a gene by replacing it to make it inoperative
Identifying the presence of a gene by editing it to produce a different protein
Editing a gene to initiate cell death
B
CRISPR-Cas9 gene editing uses a guide RNA to direct the Cas9 enzyme to a complementary DNA target, where Cas9 cuts the DNA so the sequence can be changed.
Changing the guide RNA changes the target sequence. After cutting, gene editing can delete DNA, insert or replace a sequence, or disrupt the gene so that it no longer functions.
Choose a target → design a complementary guide RNA → guide RNA directs Cas9 → Cas9 cuts near the target → the DNA is edited → verify the sequence and biological result.
Successful-use example from an official IB paper: CRISPR-Cas9 repair of a mutated DMD gene restored expression of dystrophin. Depending on the mutation, editing can replace a changed codon, add DNA missing after a deletion, or remove DNA added by an insertion.
Restoring dystrophin expression demonstrates a successful molecular result; it does not by itself prove complete, safe clinical treatment. Delivery, unintended edits and regulation must still be considered.
This objective is assessed through structured response, commonly using Explain.
Explain
Build the answer around this relationship: Guide RNA directs Cas9 to a complementary DNA target.
Representative question
Explain ways in which CRISPR-Cas9 gene editing could be used to change the mutated dystrophin protein produced.
a. gene editing requires a method for finding a target sequence in the genome/DNA/gene and replacing it with the desired sequence;
b. (gene editing could) change codon/point mutation/substitution that encodes/codes for a different amino acid (causing change in protein/dystrophin);
c. change codon that introduced a stop codon (making shorter peptide/dystrophin);
d. introduce DNA section/bases if mutation is a deletion;
e. delete DNA section/bases if mutation is an insertion;
a. both parts needed.
3 max
Conserved gene sequences remain identical or similar across species; highly conserved sequences remain similar across long evolutionary periods.
| Hypothesis | Why similarity persists |
|---|---|
| Functional requirement | Many sequence changes reduce the gene product's function, so purifying selection removes them |
| Slower mutation rate | The sequence accumulates new mutations less often than less-conserved regions |
If the same coding region is very similar in distantly related species, researchers can hypothesize that its amino-acid sequence is strongly constrained by the protein's function.
Conservation supports hypotheses; it does not by itself identify the exact function or distinguish functional constraint from a lower mutation rate. Further evidence is required.
This objective is assessed through structured response, commonly using Identify.
Identify
Build the answer around this relationship: Conserved sequences are similar across species or long evolutionary times.
Representative question
A bioinformatics analysis was performed on the protein PSY transcribed from the gene from corn and from daffodil to obtain the sequence alignment.
On the alignment, identify the longest part of the sequence where the consecutive amino acids are the same.
| Corn | ---MAI I LVRAASP-------GLSAAD---------SISH- |
|---|---|
| Daffodil | ---MVVAILRVVSAIEIPIRLGFSEANWRFSSPKYDNLGRK |
| Corn | QGTLQCSTLLKTKRPAARRWMPCSLLGLHPWEAGRP-SPAV |
| Daffodil | KSRLSVYSLYTTSKYA-----------CVGFEAENNGKFLI |
| * * * * * * | |
| Corn | YSSLPVNPAGEAVVSSEQKVYDVVLKQAALLKRQLRTP--V |
| Daffodil | RSSLVANPAGEATISSEQKVYDVVLKQAALVKDQTKSSRKS |
| * * * * * * * * * * * * * * * * * * * * * * * * * * * | |
| Corn | LDARPQDMDMPRN--GLKEAYDRCGE I CEEYAKTFYLGTML |
| Daffodil | TDVKP-DIVLPGTVYLLKDAYDRCGEVCAEYAKTFYLGTLL |
| * * * * * * * * * * * * * * * * * * * * * * * * | |
| Corn | MTEERRRA I WA I YVWCRRTDELVDGPNANY I TPTALDRWEK |
| Daffodil | MTPERRRAI WA I YVWCRRTDELVDGHNASHITPSALDRWEA |
| ** * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * | |
| Corn | RLEDLFTGRPYDMLDAALSDTISRFPIDIQPFRDMIEGMRS |
| Daffodil | RLEDLFAGRPYDMFDAALSDTVSRFPVDIQPFMDMVEGMRM |
| * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * | |
| Corn | DLRKTRYNNFDELYMYCYYVAGTVGLMSVPVMGIATESKAT |
| Daffodil | DLKKSRYKNFDELYLYCYYVAGTVGLMSVPVMGIAPESLAE |
| * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * | |
| Corn | TESVYSAALALGIANQLTNI LRDVGEDARRGRIYLPQDELA |
| Daffodil | AESVYNAALALGIANQLTNI LRDVGEDARRGRIYLPQDELA |
| * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * | |
| Corn | QAGLSDEDIFKGVVTNRWRNFMKRQIKRARMFFEEAERGVN |
| Daffodil | EAGLSDEDVFTGKVTDKWRSFMKRQIKRARTFFEQAEKGVT |
| * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * | |
| Corn | ELSQASRWPVWASLLLYRQI LDEIEANDYNNFTKRAYVGKG |
| Daffodil | E L SQA SRWP VWASLL LYRQI LDE I EANDYNNF TKRAYVSKV |
| Corn | KKLLALPVAYGKSLLLPCSLRN---GQT |
| Daffodil | KRLAALPLA YGKSLLIPLSLRPPSLSKA |
| * * * * * * * * * * * * * * * * |
sequence shown on alignment:
Corn TESVYSAALALGIANQLTNILRDVGEDARRGRIYLPQDELA
Daffodil AESVYNAALALGIANQLTNILRDVGEDARRGRIYLPQDELA
**********************************************
Corn QAGLSDEDIFKGVVTNRWRNFMKRQIKRARMFFEEAERGVN
Daffodil EAGLSDEDVFTGKVTDKWRSFMKRQIKRARTFFEQAEKGVT
*************************************
Corn ELSQASRWPVWASLLLYRQILDEIEANDYNNFTKRAYVGKG
Corn KKLLALPVAYGKSLLLPCSLRN---GQT
Daffodil KRLAALPLAYGKSLLIPLSLRPPSLSKA
Gene knockout makes a specific gene non-functional to investigate phenotype; model organisms such as mice, Drosophila, zebrafish, and Arabidopsis support KO libraries. Guide RNA directs Cas9 to a complementary DNA target sequence; Cas9 cutting enables deletion, replacement, insertion, or gene disruption. Conserved sequences remain similar across species or long evolutionary times; conservation suggests essential function, lower mutation rate, or strong purifying selection.